| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2/Bcl2-associated agonist of cell death [103-127,M117N] |
|---|
| Ligand | BDBM562363 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Protein-Protein Interaction Assay |
|---|
| IC50 | 18000±n/a nM |
|---|
| Citation |  Furst, L; Serrano-Wu, MH; Lemke, C; McKinney, D; Fitzgerald, M; Nasveschuk, C; Lazarski, K; Ferrara, SJ; Wei, G; McCarren, PR; Thede, K; Mengel, A; Christ, C; Kuhnke, J; Johannes, SA; Buchgraber, P; Klar, U; Rauh, U; Kaulfuss, S; Fernandez-Montalvan, AE; Werbeck, N; Mönning, U; Nowak-Reppel, K Macrocyclic indole derivatives US Patent US11401278 Publication Date 8/2/2022 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2/Bcl2-associated agonist of cell death [103-127,M117N] |
|---|
| Name: | Apoptosis regulator Bcl-2/Bcl2-associated agonist of cell death [103-127,M117N] |
|---|
| Synonyms: | BCL-2/Bad BH3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| Component 2 |
| Name: | Bcl2-associated agonist of cell death [103-127,M117N] |
|---|
| Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | cl2-associated agonist of cell death (BAD)(BH3) |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 3088.39 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q92934[103-127,M117N] |
|---|
| Residue: | 25 |
|---|
| Sequence: | NLWAAQRYGRELRRNSDEFVDSFKK
|
|
|
|---|
| BDBM562363 |
|---|
| n/a |
|---|
| Name | BDBM562363 |
|---|
| Synonyms: | (+)-4-chloro-3-ethyl-7-{3-[(6-fluoronaphthalen-1-yl)oxy]propyl}-2,14-dimethyl-13,13-dioxo-10,11,12,13,14,15-hexahydro-2H-13lambda6-pyrazolo[3′,4′:4,5][1,2,8]thiadiazacycloundecino-[6,7,8-hi]indole-8-carboxylic acid (Enantiomer 1) | US11401278, Example 36 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H34ClFN4O5S |
|---|
| Mol. Mass. | 653.163 |
|---|
| SMILES | CCc1c-2c(CN(C)S(=O)(=O)CCCn3c(C(O)=O)c(CCCOc4cccc5cc(F)ccc45)c4ccc(Cl)c-2c34)nn1C |
|---|
| Structure | 
|
|---|
Search and Browse
