Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Mitogen-activated protein kinase 14 |
---|
Ligand | BDBM15244 |
---|
Substrate/Competitor | biotinylated GST-ATF2 |
---|
Meas. Tech. | Enzyme Inhibition Scintillation Proximity Assay |
---|
pH | 7±n/a |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 0.8±n/a nM |
---|
Km | 96000±14000 nM |
---|
Citation | Fitzgerald, CE; Patel, SB; Becker, JW; Cameron, PM; Zaller, D; Pikounis, VB; O'Keefe, SJ; Scapin, G Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity. Nat Struct Biol10:764-9 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Mitogen-activated protein kinase 14 |
---|
Name: | Mitogen-activated protein kinase 14 |
Synonyms: | Crk1 | Csbp1 | Csbp2 | MAP Kinase p38 alpha | MAP kinase p38 | MK14_MOUSE | Mapk14 | Mitogen-activated protein kinase 14 | Mitogen-activated protein kinase p38 alpha |
Type: | Enzyme |
Mol. Mass.: | 41281.22 |
Organism: | Mus musculus (mouse) |
Description: | The full-length open reading frame of murine p38 alpha was cloned and expressed in E. coli.. Soluble murine p38R was extracted from cell pellets and purified using ion-exchange chromatography. |
Residue: | 360 |
Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
BDBM15244 |
---|
biotinylated GST-ATF2 |
---|
Name: | biotinylated GST-ATF2 |
Synonyms: | ATF-2-GST | ATF2 | Activating transcription factor 2 | Activating transcription factor 2-GST fusion | GST-ATF2 | biotinylated ATF2 substrate | biotinylated activating transcription factor 2 |
Type: | Other Protein Type |
Mol. Mass.: | 12237.77 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 109 |
Sequence: | MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPS
|
|
|