Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP1 subtype |
---|
Ligand | BDBM35853 |
---|
Substrate/Competitor | BDBM35847 |
---|
Meas. Tech. | Prostanoid EP Receptor Binding Assay |
---|
pH | 6±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | >10000±n/a nM |
---|
Citation | Asada, M; Obitsu, T; Nagase, T; Sugimoto, I; Yamaura, Y; Sato, K; Narita, M; Ohuchida, S; Nakai, H; Toda, M Discovery of a series of acrylic acids and their derivatives as chemical leads for selective EP3 receptor antagonists. Bioorg Med Chem17:6567-82 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Prostaglandin E2 receptor EP1 subtype |
---|
Name: | Prostaglandin E2 receptor EP1 subtype |
Synonyms: | PE2R1_MOUSE | PGE receptor, EP1 subtype | Prostaglandin E1 | Prostaglandin E2 receptor EP1 subtype | Prostanoid EP1 receptor | Ptger1 | Ptgerep1 |
Type: | G-protein coupled receptor |
Mol. Mass.: | 43000.62 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 405 |
Sequence: | MSPCGLNLSLADEAATCATPRLPNTSVVLPTGDNGTSPALPIFSMTLGAVSNVLALALLA
QVAGRMRRRRSAATFLLFVASLLAIDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMV
FFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALAVLAAMALAVALLPLVHVGR
YELQYPGTWCFISLGPRGGWRQALLAGLFAGLGLAALLAALVCNTLSGLALLRARWRRRR
SRRFRKTAGPDDRRRWGSRGPRLASASSASSITSATATLRSSRGGGSARRVHAHDVEMVG
QLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAVRLASWNQILDPWVYILLRQA
MLRQLLRLLPLRVSAKGGPTELGLTKSAWEASSLRSSRHSGFSHL
|
|
|
BDBM35853 |
---|
BDBM35847 |
---|
Name | BDBM35853 |
Synonyms: | acrylic acid derivative, 11 |
Type | Small organic molecule |
Emp. Form. | C23H20N2O4 |
Mol. Mass. | 388.4159 |
SMILES | OC(=O)\C=C\c1ccc(Cn2ccnc2)cc1OCCc1cc2ccccc2o1 |
Structure |
|