Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Substance-P receptor |
---|
Ligand | BDBM50081195 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Human NK1 Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 12700±n/a nM |
---|
Comments | extracted |
---|
Citation | Hoveyda, HR; Dutheuil, G; Fraser, GL; Roy, M; Bousmaqui, ME; Batt, F Chiral N-acyl-5,6,7,(8-substituted)-tetrahydro-[1,2,4]triazolo[4,3-a]pyrazines as selective NK-3 receptor antagonists, pharmaceutical composition, methods for use in NK-3 receptor mediated disorders and chiral synthesis thereof US Patent US10065961 Publication Date 9/4/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Substance-P receptor |
---|
Name: | Substance-P receptor |
Synonyms: | NK-1 receptor | NK-1R | NK1 Receptor | NK1R | NK1R_HUMAN | Neurokinin 1 receptor | Neurokinin-1 (NK-1) | Neuromedin-1 receptor (NK-1R) | SPR | TAC1R | TACR1 | Tachykinin receptor 1 | Tachykinin receptor 1 (NK1) | tachykinin |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 46254.43 |
Organism: | Homo sapiens (Human) |
Description: | P25103 |
Residue: | 407 |
Sequence: | MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
|
|
|
BDBM50081195 |
---|
n/a |
---|
Name | BDBM50081195 |
Synonyms: | CHEMBL3422010 | US10065961, Compound 1 | US10683295, Compound 1 | US10941151, Compound 1 | US9475814, 1 |
Type | Small organic molecule |
Emp. Form. | C21H19N5OS2 |
Mol. Mass. | 421.538 |
SMILES | C[C@H]1N(CCn2c1nnc2-c1csc(C)n1)C(=O)c1ccc(cc1)-c1cccs1 |r| |
Structure |
|