Reaction Details |
| Report a problem with these data |
Target | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
---|
Ligand | BDBM50249984 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1680835 |
---|
Kd | 1119±n/a nM |
---|
Citation | Jiang, Y; Zhuang, C; Chen, L; Lu, J; Dong, G; Miao, Z; Zhang, W; Li, J; Sheng, C Structural Biology-Inspired Discovery of Novel KRAS-PDE? Inhibitors. J Med Chem60:9400-9406 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
---|
Name: | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
Synonyms: | 3',5'-cyclic phosphodiesterase | GMP-PDE delta | PDE6D | PDE6D_HUMAN | PDED | Protein p17 | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
Type: | PROTEIN |
Mol. Mass.: | 17418.30 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_105761 |
Residue: | 150 |
Sequence: | MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
|
|
|
BDBM50249984 |
---|
n/a |
---|
Name | BDBM50249984 |
Synonyms: | CHEMBL4098417 |
Type | Small organic molecule |
Emp. Form. | C35H33F2N5O2 |
Mol. Mass. | 593.6656 |
SMILES | Fc1ccccc1[C@H]1Nc2ccccc2C(=O)N1CCN1CCC(CC1)N1[C@H](Nc2ccccc2C1=O)c1ccccc1F |r| |
Structure |
|