Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50283119 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_157569 |
---|
IC50 | 252±n/a nM |
---|
Citation | Tucker, TJ; Lumma, WC; Payne, LS; Wai, JM; de Solms, SJ; Giuliani, EA; Darke, PL; Heimbach, JC; Zugay, JA; Schleif, WA A series of potent HIV-1 protease inhibitors containing a hydroxyethyl secondary amine transition state isostere: synthesis, enzyme inhibition, and antiviral activity. J Med Chem35:2525-33 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50283119 |
---|
n/a |
---|
Name | BDBM50283119 |
Synonyms: | CHEMBL69604 | {(1S,2R)-1-Benzyl-2-hydroxy-3-[(1R,2S)-1-((S)-2-hydroxy-indan-1-ylcarbamoyl)-2-phenyl-ethylamino]-propyl}-carbamic acid tert-butyl ester | {(1S,2R)-1-Benzyl-2-hydroxy-3-[(S)-1-((1S,2R)-2-hydroxy-indan-1-ylcarbamoyl)-2-phenyl-ethylamino]-propyl}-carbamic acid tert-butyl ester | {1-Benzyl-2-hydroxy-3-[1-(2-hydroxy-indan-1-ylcarbamoyl)-2-phenyl-ethylamino]-propyl}-carbamic acid tert-butyl ester |
Type | Small organic molecule |
Emp. Form. | C33H41N3O5 |
Mol. Mass. | 559.6957 |
SMILES | CC(C)(C)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |
Structure |
|