| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Ligand | BDBM50258941 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1690808 |
|---|
| Ki | 100±n/a nM |
|---|
| Citation |  ?pa?ek, P; Keough, DT; Chavchich, M; Dra?ínský, M; Janeba, Z; Naesens, L; Edstein, MD; Guddat, LW; Hocková, D Synthesis and Evaluation of Asymmetric Acyclic Nucleoside Bisphosphonates as Inhibitors of Plasmodium falciparum and Human Hypoxanthine-Guanine-(Xanthine) Phosphoribosyltransferase. J Med Chem60:7539-7554 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Name: | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24579.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00492 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
|---|
| BDBM50258941 |
|---|
| n/a |
|---|
| Name | BDBM50258941 |
|---|
| Synonyms: | CHEMBL4078513 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H16BrN5Na4O9P2 |
|---|
| Mol. Mass. | 608.094 |
|---|
| SMILES | [Na+].[Na+].[Na+].[Na+].Nc1nc2n(CC(COCCP([O-])([O-])=O)COCP([O-])([O-])=O)c(Br)nc2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
