Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-2 |
---|
Ligand | BDBM50458002 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1761589 (CHEMBL4196836) |
---|
IC50 | >8000±n/a nM |
---|
Citation | Tanaka, M; Zhu, Y; Shionyu, M; Ota, N; Shibata, N; Watanabe, C; Mizusawa, A; Sasaki, R; Mizukami, T; Shiina, I; Hasegawa, M Ridaifen-F conjugated with cell-penetrating peptides inhibits intracellular proteasome activities and induces drug-resistant cell death. Eur J Med Chem146:636-650 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-2 |
---|
Name: | Proteasome subunit beta type-2 |
Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
Type: | PROTEIN |
Mol. Mass.: | 22837.53 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1294233 |
Residue: | 201 |
Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
BDBM50458002 |
---|
n/a |
---|
Name | BDBM50458002 |
Synonyms: | CHEMBL4212914 |
Type | Small organic molecule |
Emp. Form. | C52H103N33O11 |
Mol. Mass. | 1366.5887 |
SMILES | CC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O |r| |
Structure |
|