| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50463290 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1777973 (CHEMBL4234965) |
|---|
| Ki | 104±n/a nM |
|---|
| Citation |  Sun, HJ; Wang, YH; Yuan, CM; Kong, LH; Xu, XJ; Wang, YJ; Wu, HH; Lin, C; Qian, YY; Huang, HM; Xiao, L; Liu, X; He, Q; Fang, SY; Xue, DQ; Yang, XC; Chen, H; Zheng, YL; Zheng, L; Yu, LQ; Xie, Q; Fu, W; Li, W; Liu, JG; Qiu, ZB; Shao, LM 7?-Methyl substituent is a structural locus associated with activity cliff for nepenthone analogues. Bioorg Med Chem26:4254-4263 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50463290 |
|---|
| n/a |
|---|
| Name | BDBM50463290 |
|---|
| Synonyms: | CHEMBL4241031 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H35NO5 |
|---|
| Mol. Mass. | 453.5705 |
|---|
| SMILES | [H][C@@]12Oc3c4c(C[C@@]5([H])N(CC6CC6)CC[C@@]14[C@@]51CC[C@@]2(OC)[C@](C)(C1)OC(C)=O)ccc3OC |r,THB:10:9:17:5.6.4| |
|---|
| Structure | 
|
|---|
Search and Browse
