| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50478750 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_534522 (CHEMBL984612) |
|---|
| IC50 | 1400±n/a nM |
|---|
| Citation |  Cesarini, S; Spallarossa, A; Ranise, A; Bruno, O; La Colla, P; Secci, B; Collu, G; Loddo, R Thiocarbamates as non-nucleoside HIV-1 reverse transcriptase inhibitors. Part 2: Parallel synthesis, molecular modelling and structure-activity relationship studies on analogues of O-(2-phenylethyl)-N-phenylthiocarbamate. Bioorg Med Chem16:4173-85 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50478750 |
|---|
| n/a |
|---|
| Name | BDBM50478750 |
|---|
| Synonyms: | CHEMBL471691 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H19NO2S |
|---|
| Mol. Mass. | 301.403 |
|---|
| SMILES | CC(COc1ccccc1)OC(=S)Nc1ccc(C)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
