| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50482811 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_664340 (CHEMBL1259489) |
|---|
| IC50 | 95±n/a nM |
|---|
| Citation |  Le, G; Vandegraaff, N; Rhodes, DI; Jones, ED; Coates, JA; Thienthong, N; Winfield, LJ; Lu, L; Li, X; Yu, C; Feng, X; Deadman, JJ Design of a series of bicyclic HIV-1 integrase inhibitors. Part 2: azoles: effective metal chelators. Bioorg Med Chem Lett20:5909-12 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50482811 |
|---|
| n/a |
|---|
| Name | BDBM50482811 |
|---|
| Synonyms: | CHEMBL1258504 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H25FN6O5S |
|---|
| Mol. Mass. | 540.567 |
|---|
| SMILES | Oc1c(nc2c(cc(cn2c1=O)N1CCOCC1)N1CCCS1(=O)=O)-c1ncc(Cc2ccc(F)cc2)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
