Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50485255 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_823533 (CHEMBL2045976) |
---|
IC50 | 12±n/a nM |
---|
Citation | Wang, X; Zhang, J; Huang, Y; Wang, R; Zhang, L; Qiao, K; Li, L; Liu, C; Ouyang, Y; Xu, W; Zhang, Z; Zhang, L; Shao, Y; Jiang, S; Ma, L; Liu, J Design, synthesis, and biological evaluation of 1-[(2-benzyloxyl/alkoxyl)methyl]-5-halo-6-aryluracils as potent HIV-1 non-nucleoside reverse transcriptase inhibitors with an improved drug resistance profile. J Med Chem55:2242-50 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50485255 |
---|
n/a |
---|
Name | BDBM50485255 |
Synonyms: | CHEMBL2041791 |
Type | Small organic molecule |
Emp. Form. | C21H23N3O3 |
Mol. Mass. | 365.4256 |
SMILES | CN(C)c1c(Cc2ccccc2)n(COCc2ccccc2)c(=O)[nH]c1=O |
Structure |
|