| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B1 |
|---|
| Ligand | BDBM50049730 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_877418 (CHEMBL2182848) |
|---|
| IC50 | 170±n/a nM |
|---|
| Citation |  Sartini, S; Cosconati, S; Marinelli, L; Barresi, E; Di Maro, S; Simorini, F; Taliani, S; Salerno, S; Marini, AM; Da Settimo, F; Novellino, E; La Motta, C Benzofuroxane derivatives as multi-effective agents for the treatment of cardiovascular diabetic complications. Synthesis, functional evaluation, and molecular modeling studies. J Med Chem55:10523-31 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B1 |
|---|
| Name: | Aldo-keto reductase family 1 member B1 |
|---|
| Synonyms: | ALDR_RAT | Akr1b1 | Akr1b4 | Aldose reductase | Aldr1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35797.87 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1512484 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
|
|
|
|---|
| BDBM50049730 |
|---|
| n/a |
|---|
| Name | BDBM50049730 |
|---|
| Synonyms: | 2-(5-(2-methyl-3-phenylallylidene)-4-oxo-2-thioxothiazolidin-3-yl)acetic acid | CHEMBL56337 | Epalrestat | {5-[(E)-2-Methyl-3-phenyl-prop-2-en-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-acetic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H13NO3S2 |
|---|
| Mol. Mass. | 319.399 |
|---|
| SMILES | C\C(\C=C1/SC(=S)N(CC(O)=O)C1=O)=C/c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
