| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50038006 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_136090 (CHEMBL745613) |
|---|
| IC50 | 51±n/a nM |
|---|
| Citation |  Meyer, JP; Collins, N; Lung, FD; Davis, P; Zalewska, T; Porreca, F; Yamamura, HI; Hruby, VJ Design, synthesis, and biological properties of highly potent cyclic dynorphin A analogues. Analogues cyclized between positions 5 and 11. J Med Chem37:3910-7 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50038006 |
|---|
| n/a |
|---|
| Name | BDBM50038006 |
|---|
| Synonyms: | CHEMBL404929 | Tyr-Gly-Gly-Phe-D-Pen-Arg-Arg-Ile-Arg-Pro-D-Cys-NH2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C61H97N21O12S2 |
|---|
| Mol. Mass. | 1380.686 |
|---|
| SMILES | CC[C@H](C)[C@H]1NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc2ccc(O)cc2)C(C)(C)SCCSC[C@H](NC(=O)[C@H]2CCCN2C(=O)[C@H](CCCNC(N)=N)NC1=O)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
