| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM23563 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_216470 (CHEMBL818540) |
|---|
| Ki | 340±n/a nM |
|---|
| Citation |  Pochet, L; Doucet, C; Schynts, M; Thierry, N; Boggetto, N; Pirotte, B; Jiang, KY; Masereel, B; de Tullio, P; Delarge, J; Reboud-Ravaux, M Esters and amides of 6-(chloromethyl)-2-oxo-2H-1-benzopyran-3-carboxylic acid as inhibitors of alpha-chymotrypsin: significance of the"aromatic" nature of the novel ester-type coumarin for strong inhibitory activity. J Med Chem39:2579-85 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM23563 |
|---|
| n/a |
|---|
| Name | BDBM23563 |
|---|
| Synonyms: | 3-Carboxylate-coumarin deriv., 3 | CHEMBL13357 | phenyl 6-(chloromethyl)-2-oxo-2H-chromene-3-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H11ClO4 |
|---|
| Mol. Mass. | 314.72 |
|---|
| SMILES | ClCc1ccc2oc(=O)c(cc2c1)C(=O)Oc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
