| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50068132 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_76016 (CHEMBL685497) |
|---|
| EC50 | 7600±n/a nM |
|---|
| Citation |  Liao, S; Alfaro-Lopez, J; Shenderovich, MD; Hosohata, K; Lin, J; Li, X; Stropova, D; Davis, P; Jernigan, KA; Porreca, F; Yamamura, HI; Hruby, VJ De novo design, synthesis, and biological activities of high-affinity and selective non-peptide agonists of the delta-opioid receptor. J Med Chem41:4767-76 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50068132 |
|---|
| n/a |
|---|
| Name | BDBM50068132 |
|---|
| Synonyms: | 3-[(4-Benzyl-piperazin-1-yl)-(4-tert-butyl-phenyl)-methyl]-phenol | CHEMBL143592 | SL-3111 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H34N2O |
|---|
| Mol. Mass. | 414.5824 |
|---|
| SMILES | CC(C)(C)c1ccc(cc1)C(N1CCN(Cc2ccccc2)CC1)c1cccc(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
