Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Proteasome subunit beta type-9 |
---|
Ligand | BDBM50526810 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1909303 (CHEMBL4411749) |
---|
IC50 | 223±n/a nM |
---|
Citation | Johnson, HWB; Lowe, E; Anderl, JL; Fan, A; Muchamuel, T; Bowers, S; Moebius, DC; Kirk, C; McMinn, DL Required Immunoproteasome Subunit Inhibition Profile for Anti-Inflammatory Efficacy and Clinical Candidate KZR-616 ((2 S,3 R)- N-(( S)-3-(Cyclopent-1-en-1-yl)-1-(( R)-2-methyloxiran-2-yl)-1-oxopropan-2-yl)-3-hydroxy-3-(4-methoxyphenyl)-2-(( S)-2-(2-morpholinoacetamido)propanamido)propenamide). J Med Chem61:11127-11143 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-9 |
---|
Name: | Proteasome subunit beta type-9 |
Synonyms: | LMP2 | Low molecular mass protein 2 | Macropain chain 7 | Multicatalytic endopeptidase complex chain 7 | PSB9_HUMAN | PSMB6i | PSMB9 | Proteasome chain 7 | Proteasome subunit beta-1i | RING12 | Really interesting new gene 12 protein |
Type: | PROTEIN |
Mol. Mass.: | 23256.49 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_106197 |
Residue: | 219 |
Sequence: | MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHER
IYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMV
AGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIA
LAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
|
|
|
BDBM50526810 |
---|
n/a |
---|
Name | BDBM50526810 |
Synonyms: | CHEMBL4443505 |
Type | Small organic molecule |
Emp. Form. | C30H42N4O7 |
Mol. Mass. | 570.6771 |
SMILES | COc1ccc(C[C@H](NC(=O)[C@H](C)NC(=O)CN2CCOCC2)C(=O)N[C@@H](CC2=CCCC2)C(=O)[C@@]2(C)CO2)cc1 |r,t:29| |
Structure |
|