Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 3 |
---|
Ligand | BDBM23165 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_304343 (CHEMBL839769) |
---|
pH | 7.4±n/a |
---|
EC50 | 3.1±n/a nM |
---|
Comments | extracted |
---|
Citation | Albert, R; Hinterding, K; Brinkmann, V; Guerini, D; Müller-Hartwieg, C; Knecht, H; Simeon, C; Streiff, M; Wagner, T; Welzenbach, K; Zécri, F; Zollinger, M; Cooke, N; Francotte, E Novel immunomodulator FTY720 is phosphorylated in rats and humans to form a single stereoisomer. Identification, chemical proof, and biological characterization of the biologically active species and its enantiomer. J Med Chem48:5373-7 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 3 |
---|
Name: | Sphingosine 1-phosphate receptor 3 |
Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 42278.13 |
Organism: | Homo sapiens (Human) |
Description: | Q99500 |
Residue: | 378 |
Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
BDBM23165 |
---|
n/a |
---|
Name | BDBM23165 |
Synonyms: | CHEMBL366208 | FTY720-phosphate, (S)-2 | [(2S)-2-amino-3-hydroxy-2-[2-(4-octylphenyl)ethyl]propoxy]phosphonic acid |
Type | Small organic molecule |
Emp. Form. | C19H34NO5P |
Mol. Mass. | 387.4507 |
SMILES | CCCCCCCCc1ccc(CC[C@](N)(CO)COP(O)(O)=O)cc1 |r| |
Structure |
|