Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 1 |
---|
Ligand | BDBM50186934 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_376406 (CHEMBL866632) |
---|
EC50 | 0.11±n/a nM |
---|
Citation | Yan, L; Huo, P; Doherty, G; Toth, L; Hale, JJ; Mills, SG; Hajdu, R; Keohane, CA; Rosenbach, MJ; Milligan, JA; Shei, GJ; Chrebet, G; Bergstrom, J; Card, D; Quackenbush, E; Wickham, A; Mandala, SM Discovery of 3-arylpropionic acids as potent agonists of sphingosine-1-phosphate receptor-1 (S1P1) with high selectivity against all other known S1P receptor subtypes. Bioorg Med Chem Lett16:3679-83 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 1 |
---|
Name: | Sphingosine 1-phosphate receptor 1 |
Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
Type: | Enzyme |
Mol. Mass.: | 42836.02 |
Organism: | Homo sapiens (Human) |
Description: | P21453 |
Residue: | 382 |
Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
BDBM50186934 |
---|
n/a |
---|
Name | BDBM50186934 |
Synonyms: | 3-(4-(5-(3-cyano-4-(2,2,2-trifluoroethoxy)phenyl)-1,2,4-oxadiazol-3-yl)-3-methylphenyl)propanoic acid | CHEMBL379380 |
Type | Small organic molecule |
Emp. Form. | C21H16F3N3O4 |
Mol. Mass. | 431.3646 |
SMILES | Cc1cc(CCC(O)=O)ccc1-c1noc(n1)-c1ccc(OCC(F)(F)F)c(c1)C#N |
Structure |
|