Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50282537 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_79795 (CHEMBL696055) |
---|
IC50 | 5±n/a nM |
---|
Citation | Dorsselaer, VV; Schirlin, D; Tarnus, C; Taylor, DL; Tyms, AS; Weber, F; Baltzer, S; Remy, JM; Brennan, T; Janowick, D Increased antiviral activity of HIV protease inhibitors of the difluorostatone type bearing (R)-valinol derivatives as novel c-termini Bioorg Med Chem Lett4:1213-1218 (1994) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50282537 |
---|
n/a |
---|
Name | BDBM50282537 |
Synonyms: | CHEMBL264739 | {(S)-1-[1-(4-Benzyloxy-benzyl)-3,3-difluoro-3-isobutylcarbamoyl-2-oxo-propylcarbamoyl]-2-methyl-propyl}-carbamic acid benzyl ester |
Type | Small organic molecule |
Emp. Form. | C35H41F2N3O6 |
Mol. Mass. | 637.7133 |
SMILES | CC(C)CNC(=O)C(F)(F)C(=O)C(Cc1ccc(OCc2ccccc2)cc1)NC(=O)[C@@H](NC(=O)OCc1ccccc1)C(C)C |
Structure |
|