| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50065788 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_90580 (CHEMBL701164) |
|---|
| IC50 | 2700±n/a nM |
|---|
| Citation |  Ouali, M; Laboulais, C; Leh, H; Gill, D; Desmaële, D; Mekouar, K; Zouhiri, F; d'Angelo, J; Auclair, C; Mouscadet, JF; Le Bret, M Modeling of the inhibition of retroviral integrases by styrylquinoline derivatives. J Med Chem43:1949-57 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50065788 |
|---|
| n/a |
|---|
| Name | BDBM50065788 |
|---|
| Synonyms: | (E)-2-(3-carboxy-4-hydroxystyryl)-8-hydroxyquinoline-7-carboxylic acid | 2-(3-carboxy-4-hydroxystyryl)-8-hydroxyquinoline-7-carboxylic acid | 2-[(E)-2-(3-Carboxy-4-hydroxy-phenyl)-vinyl]-8-hydroxy-quinoline-7-carboxylic acid | 2-[2-(3-Carboxy-4-hydroxy-phenyl)-vinyl]-8-hydroxy-quinoline-7-carboxylic acid | CHEMBL59548 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H13NO6 |
|---|
| Mol. Mass. | 351.3096 |
|---|
| SMILES | OC(=O)c1ccc2ccc(\C=C\c3ccc(O)c(c3)C(O)=O)nc2c1O |
|---|
| Structure | 
|
|---|
Search and Browse
