| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50131726 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_37039 (CHEMBL650835) |
|---|
| IC50 | 12±n/a nM |
|---|
| Citation |  Cappelli, A; Pericot Mohr, G; Gallelli, A; Giuliani, G; Anzini, M; Vomero, S; Fresta, M; Porcu, P; Maciocco, E; Concas, A; Biggio, G; Donati, A Structure-activity relationships in carboxamide derivatives based on the targeted delivery of radionuclides and boron atoms by means of peripheral benzodiazepine receptor ligands. J Med Chem46:3568-71 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50131726 |
|---|
| n/a |
|---|
| Name | BDBM50131726 |
|---|
| Synonyms: | 3-Diethylaminomethyl-4-phenyl-quinoline-2-carboxylic acid benzyl-methyl-amide | CHEMBL331928 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H31N3O |
|---|
| Mol. Mass. | 437.5759 |
|---|
| SMILES | CCN(CC)Cc1c(nc2ccccc2c1-c1ccccc1)C(=O)N(C)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
