Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase 16 |
---|
Ligand | BDBM31093 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_586858 (CHEMBL1051353) |
---|
Kd | >10000±n/a nM |
---|
Citation | Karaman, MW; Herrgard, S; Treiber, DK; Gallant, P; Atteridge, CE; Campbell, BT; Chan, KW; Ciceri, P; Davis, MI; Edeen, PT; Faraoni, R; Floyd, M; Hunt, JP; Lockhart, DJ; Milanov, ZV; Morrison, MJ; Pallares, G; Patel, HK; Pritchard, S; Wodicka, LM; Zarrinkar, PP A quantitative analysis of kinase inhibitor selectivity. Nat Biotechnol26:127-32 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase 16 |
---|
Name: | Serine/threonine-protein kinase 16 |
Synonyms: | MPSK1 | PKL12 | STK16 | STK16_HUMAN | Serine/threonine-protein kinase 16 | TSF1 | Tyrosine-protein kinase STK16 (STK16) |
Type: | Protein |
Mol. Mass.: | 34659.07 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 305 |
Sequence: | MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDRE
EAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFL
TEDQILWLLLGICRGLEAIHAKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIHVEGS
RQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQ
KGDSVALAVQNQLSIPQSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEALQPPAPGQ
HTTQI
|
|
|
BDBM31093 |
---|
n/a |
---|
Name | BDBM31093 |
Synonyms: | 4-[[7-[2,6-bis(fluoranyl)phenyl]-9-chloranyl-5H-pyrimido[5,4-d][2]benzazepin-2-yl]amino]benzoic acid | 4-[[9-chloro-7-(2,6-difluorophenyl)-5H-pyrimido[5,4-d][2]benzazepin-2-yl]amino]benzoic acid | BDBM31832 | CHEMBL259084 | MLN-8054 | cid_11712649 |
Type | Small organic molecule |
Emp. Form. | C25H15ClF2N4O2 |
Mol. Mass. | 476.862 |
SMILES | OC(=O)c1ccc(Nc2ncc3CN=C(c4cc(Cl)ccc4-c3n2)c2c(F)cccc2F)cc1 |c:13| |
Structure |
|