Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | G-protein coupled bile acid receptor 1 |
---|
Ligand | BDBM50414954 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_593388 (CHEMBL1040516) |
---|
EC50 | 31.62±n/a nM |
---|
Citation | Evans, KA; Budzik, BW; Ross, SA; Wisnoski, DD; Jin, J; Rivero, RA; Vimal, M; Szewczyk, GR; Jayawickreme, C; Moncol, DL; Rimele, TJ; Armour, SL; Weaver, SP; Griffin, RJ; Tadepalli, SM; Jeune, MR; Shearer, TW; Chen, ZB; Chen, L; Anderson, DL; Becherer, JD; De Los Frailes, M; Colilla, FJ Discovery of 3-aryl-4-isoxazolecarboxamides as TGR5 receptor agonists. J Med Chem52:7962-5 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
G-protein coupled bile acid receptor 1 |
---|
Name: | G-protein coupled bile acid receptor 1 |
Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 35260.02 |
Organism: | Homo sapiens (Human) |
Description: | CHO cells transiently transfected with hTGR5. |
Residue: | 330 |
Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
BDBM50414954 |
---|
n/a |
---|
Name | BDBM50414954 |
Synonyms: | CHEMBL575966 |
Type | Small organic molecule |
Emp. Form. | C18H14Cl2N2O2 |
Mol. Mass. | 361.222 |
SMILES | CN(C(=O)c1c(C)onc1-c1ccccc1Cl)c1ccc(Cl)cc1 |
Structure |
|