| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled bile acid receptor 1 |
|---|
| Ligand | BDBM50414954 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_593388 (CHEMBL1040516) |
|---|
| EC50 | 31.62±n/a nM |
|---|
| Citation |  Evans, KA; Budzik, BW; Ross, SA; Wisnoski, DD; Jin, J; Rivero, RA; Vimal, M; Szewczyk, GR; Jayawickreme, C; Moncol, DL; Rimele, TJ; Armour, SL; Weaver, SP; Griffin, RJ; Tadepalli, SM; Jeune, MR; Shearer, TW; Chen, ZB; Chen, L; Anderson, DL; Becherer, JD; De Los Frailes, M; Colilla, FJ Discovery of 3-aryl-4-isoxazolecarboxamides as TGR5 receptor agonists. J Med Chem52:7962-5 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled bile acid receptor 1 |
|---|
| Name: | G-protein coupled bile acid receptor 1 |
|---|
| Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 35260.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | CHO cells transiently transfected with hTGR5. |
|---|
| Residue: | 330 |
|---|
| Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
|---|
| BDBM50414954 |
|---|
| n/a |
|---|
| Name | BDBM50414954 |
|---|
| Synonyms: | CHEMBL575966 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H14Cl2N2O2 |
|---|
| Mol. Mass. | 361.222 |
|---|
| SMILES | CN(C(=O)c1c(C)onc1-c1ccccc1Cl)c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
