| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM50425816 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_937598 (CHEMBL2321067) |
|---|
| IC50 | 3900±n/a nM |
|---|
| Citation |  He, Y; Xu, J; Yu, ZH; Gunawan, AM; Wu, L; Wang, L; Zhang, ZY Discovery and evaluation of novel inhibitors of mycobacterium protein tyrosine phosphatase B from the 6-Hydroxy-benzofuran-5-carboxylic acid scaffold. J Med Chem56:832-42 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM50425816 |
|---|
| n/a |
|---|
| Name | BDBM50425816 |
|---|
| Synonyms: | CHEMBL2316910 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H12F2O4 |
|---|
| Mol. Mass. | 390.3358 |
|---|
| SMILES | OC(=O)c1cc2c(C#Cc3ccc(F)cc3F)c(oc2cc1O)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
