Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50381828 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1277909 (CHEMBL3094753) |
---|
IC50 | 340±n/a nM |
---|
Citation | Nishikawa-Shimono, R; Sekiguchi, Y; Koami, T; Kawamura, M; Wakasugi, D; Watanabe, K; Wakahara, S; Kimura, K; Yamanobe, S; Takayama, T Isoquinoline derivatives as potent CRTH2 antagonists: design, synthesis and SAR. Bioorg Med Chem21:7674-85 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
Type: | Enzyme |
Mol. Mass.: | 43295.45 |
Organism: | Homo sapiens (Human) |
Description: | Q9Y5Y4 |
Residue: | 395 |
Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
BDBM50381828 |
---|
n/a |
---|
Name | BDBM50381828 |
Synonyms: | CHEMBL2023654 |
Type | Small organic molecule |
Emp. Form. | C24H16Cl2N2O5S |
Mol. Mass. | 515.365 |
SMILES | OC(=O)Cc1cnc(C(=O)c2ccc(NS(=O)(=O)c3ccc(Cl)c(Cl)c3)cc2)c2ccccc12 |
Structure |
|