Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 2 |
---|
Ligand | BDBM50036804 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1434449 (CHEMBL3388266) |
---|
IC50 | 16±n/a nM |
---|
Citation | Lu, H; Yang, T; Xu, Z; Wren, PB; Zhang, Y; Cai, X; Patel, M; Dong, K; Zhang, Q; Zhang, W; Guan, X; Xiang, J; Elliott, JD; Lin, X; Ren, F 2-Aminopyrimidin-4(1H)-one as the novel bioisostere of urea: discovery of novel and potent CXCR2 antagonists. Bioorg Med Chem Lett24:5493-6 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 2 |
---|
Name: | C-X-C chemokine receptor type 2 |
Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
Type: | Protein |
Mol. Mass.: | 40767.88 |
Organism: | Homo sapiens (Human) |
Description: | P25025 |
Residue: | 360 |
Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
BDBM50036804 |
---|
n/a |
---|
Name | BDBM50036804 |
Synonyms: | CHEMBL3355240 |
Type | Small organic molecule |
Emp. Form. | C18H22ClN3O4S |
Mol. Mass. | 411.903 |
SMILES | CC(C)S(=O)(=O)c1c(Cl)ccc(Nc2nc(=O)cc([nH]2)C2(C)CCC2)c1O |
Structure |
|