| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50122064 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1517226 (CHEMBL3620210) |
|---|
| IC50 | 10.0±n/a nM |
|---|
| Citation |  Deekonda, S; Wugalter, L; Rankin, D; Largent-Milnes, TM; Davis, P; Wang, Y; Bassirirad, NM; Lai, J; Kulkarni, V; Vanderah, TW; Porreca, F; Hruby, VJ Design and synthesis of novel bivalent ligands (MOR and DOR) by conjugation of enkephalin analogues with 4-anilidopiperidine derivatives. Bioorg Med Chem Lett25:4683-8 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50122064 |
|---|
| n/a |
|---|
| Name | BDBM50122064 |
|---|
| Synonyms: | CHEMBL3617470 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C51H64N8O7 |
|---|
| Mol. Mass. | 901.1033 |
|---|
| SMILES | CCC(=O)N(C1CCN(Cc2cccc3[C@@H](CCCc23)NC(=O)CCNC(=O)[C@H](Cc2ccccc2)NC(=O)CNC(=O)[C@@H](C)NC(=O)[C@@H](N)Cc2ccc(O)cc2)CC1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
