Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Bcl-2-like protein 2 |
---|
Ligand | BDBM109232 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | SPR Directy Binding Assay (Biacore 4000) |
---|
pH | 7.4±n/a |
---|
IC50 | >10000±0.0 nM |
---|
Comments | extracted |
---|
Citation | Lessene, G; Czabotar, PE; Sleebs, BE; Zobel, K; Lowes, KN; Adams, JM; Baell, JB; Colman, PM; Deshayes, K; Fairbrother, WJ; Flygare, JA; Gibbons, P; Kersten, WJ; Kulasegaram, S; Moss, RM; Parisot, JP; Smith, BJ; Street, IP; Yang, H; Huang, DC; Watson, KG Structure-guided design of a selective BCL-X(L) inhibitor. Nat Chem Biol9:390-7 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-like protein 2 |
---|
Name: | Bcl-2-like protein 2 |
Synonyms: | Apoptosis regulator Bcl-W | B2CL2_HUMAN | BCL-W | BCL2L2 | BCLW | Bcl-2-like protein 2 | Bcl2-L-2 | KIAA0271 |
Type: | Protein |
Mol. Mass.: | 20742.61 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 193 |
Sequence: | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
|
|
|
BDBM109232 |
---|
n/a |
---|
Name | BDBM109232 |
Synonyms: | 6-(8-(2-(Benzothiazol-2-yl)hydrazono)-5,6,7,8-tetrahydronaphthalen-2-yl)picolinic acid (Compound 3) | CHEMBL2398173 |
Type | Small organic molecule |
Emp. Form. | C23H18N4O2S |
Mol. Mass. | 414.48 |
SMILES | OC(=O)c1cccc(n1)-c1ccc2CCCC(=NNc3nc4ccccc4s3)c2c1 |w:17.18| |
Structure |
|