Reaction Details |
| Report a problem with these data |
Target | ATP-sensitive inward rectifier potassium channel 1 |
---|
Ligand | BDBM194977 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Thallium Flux Assay |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 30±n/a nM |
---|
Comments | extracted |
---|
Citation | Ding, F; Dong, S; Frie, J; Gu, X; Jiang, J; Pasternak, A; Tang, H; Wu, Z; Yu, Y; Suzuki, T Inhibitors of the renal outer medullary potassium channel US Patent US9206198 Publication Date 12/8/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
ATP-sensitive inward rectifier potassium channel 1 |
---|
Name: | ATP-sensitive inward rectifier potassium channel 1 |
Synonyms: | ATP-regulated potassium channel ROM-K | ATP-regulated potassium channel ROMK | ATP-sensitive inward rectifier potassium channel 1 | Egl nine homolog 1 | KCNJ1 | KCNJ1_HUMAN | Potassium channel (ATP modulatory) | Potassium inwardly-rectifying channel, subfamily J, member 1 | ROMK1 | Renal Outer Medullary Potassium (ROMK1) | The Renal Outer Medullary Potassium (ROMK) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 44809.08 |
Organism: | Homo sapiens (Human) |
Description: | gi_223460826 |
Residue: | 391 |
Sequence: | MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
|
|
|
BDBM194977 |
---|
n/a |
---|
Name | BDBM194977 |
Synonyms: | US9206198, 36 |
Type | Small organic molecule |
Emp. Form. | C24H26N2O7 |
Mol. Mass. | 454.4724 |
SMILES | CC1=C(COC1=O)N1CC(=O)C2(CCN(C[C@H](O)c3ccc4C(=O)OCc4c3C)CC2)C1=O |r,t:1| |
Structure |
|