Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2a
LigandBDBM50200986
Substrate/Competitorn/a
Meas. Tech.A2a Ki assay
Ki 0.500±n/a nM
Citation Ali AKuang RLim YLo MMTing PCBiju Pde Lera Ruiz MDegrado SJTung ALHenderson TJHong LKim JKim DWLee JWu JWu HXiao YYu TZhou GZhu XMcCormick KDTagat JRXiao DKhan TCao JBerlin MZhang Y Aminoquinazoline compounds as A2A antagonist US Patent  US10138212 Publication Date 11/27/2018
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2a
Name:Adenosine receptor A2a
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50200986
n/a
NameBDBM50200986
Synonyms:CHEMBL3902955 | US10138212, Example 48
TypeSmall organic molecule
Emp. Form.C22H25N5O3
Mol. Mass.407.4656
SMILESCOc1cccc2c(nc(N)nc12)C(=O)NCc1cccc(COC2CCCC2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: