| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM8123 |
|---|
| Substrate/Competitor | Fluorogenic Substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 370±n/a nM |
|---|
| IC50 | 530±n/a nM |
|---|
| Km | 39000±n/a nM |
|---|
| Comments | Ki and IC50 values were measured from racemic structures. |
|---|
| Citation |  Specker, E; Bottcher, J; Heine, A; Sotriffer, CA; Lilie, H; Schoop, A; Muller, G; Griebenow, N; Klebe, G Hydroxyethylene sulfones as a new scaffold to address aspartic proteases: design, synthesis, and structural characterization. J Med Chem48:6607-19 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV-1 Protease |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10822.21 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P12497[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10822.21 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P12497[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM8123 |
|---|
| Fluorogenic Substrate |
|---|
| Name: | Fluorogenic Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 4084.45 |
|---|
| Organism: | n/a |
|---|
| Description: | Purchased from Bachem |
|---|
| Residue: | 36 |
|---|
| Sequence: | Abz-Thr-Ile-p-nitrophenylalanine-Phe-Gln-Arg-NH2
|
|
|
|---|
Search and Browse
