| Reaction Details |
|---|
 | Report a problem with these data |
| Target | VIM-1 metallo-beta-lactamase |
|---|
| Ligand | BDBM530911 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Activity: Determination of IC50 |
|---|
| IC50 | 0.190±n/a nM |
|---|
| Citation |  Pasternak, A; Dong, S; Scott, JD; Tang, H; Zhao, Z; Yang, D; Gu, X; Jiang, J; Xiao, L Metallo-beta-lactamase inhibitors and methods of use thereof US Patent US11207312 Publication Date 12/28/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| VIM-1 metallo-beta-lactamase |
|---|
| Name: | VIM-1 metallo-beta-lactamase |
|---|
| Synonyms: | Beta-lactamase VIM-1 | VIM-1 | VIM-1 metallo-beta-lactamase | blaVIM-1 |
|---|
| Type: | undefined |
|---|
| Mol. Mass.: | 28014.53 |
|---|
| Organism: | Klebsiella pneumoniae |
|---|
| Description: | Q5GN09 |
|---|
| Residue: | 266 |
|---|
| Sequence: | MLKVISSLLVYMTASVMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQ
SFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRV
GGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS
TDNLVVYVPSANVLYGGCAVHELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGH
GLPGGLDLLQHTANVVKAHKNRSVAE
|
|
|
|---|
| BDBM530911 |
|---|
| n/a |
|---|
| Name | BDBM530911 |
|---|
| Synonyms: | N1-(2- aminoethyl)-4-(4- (hydroxymethyl) piperidin-1-yl)-3- (1H-tetrazol-5- yl)benzene-1,2- disulfonamide | US11207312, Example 43 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H24N8O5S2 |
|---|
| Mol. Mass. | 460.532 |
|---|
| SMILES | NCCNS(=O)(=O)c1ccc(N2CCC(CO)CC2)c(-c2nnn[nH]2)c1S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
