| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM177794 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarisation Assay |
|---|
| IC50 | 18±n/a nM |
|---|
| Citation |  Le Diguarher, T; Casara, P; Starck, J; Henlin, J; Davidson, JE; Murray, JB; Graham, CJ; Chen, I; Geneste, O; Hickman, J; Depil, S; Le Tiran, A; Nyerges, M; De Nanteuil, G Indolizine compounds, a process for their preparation and pharmaceutical compositions containing them US Patent US9603854 Publication Date 3/28/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM177794 |
|---|
| n/a |
|---|
| Name | BDBM177794 |
|---|
| Synonyms: | US9120791, Example 10 | US9120791, Example 37 | US9603854, 37 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C46H45N5O6 |
|---|
| Mol. Mass. | 763.8794 |
|---|
| SMILES | Cn1ccc2cc(ccc12)N(C(=O)c1cc(-c2cc3OCOc3cc2C(=O)N2Cc3ccccc3C[C@H]2CN2CCOCC2)n2CCCCc12)c1ccc(O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
