Reaction Details |
| Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM177824 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorescence Polarisation Assay |
---|
IC50 | 110±n/a nM |
---|
Citation | Le Diguarher, T; Casara, P; Starck, J; Henlin, J; Davidson, JE; Murray, JB; Graham, CJ; Chen, I; Geneste, O; Hickman, J; Depil, S; Le Tiran, A; Nyerges, M; De Nanteuil, G Indolizine compounds, a process for their preparation and pharmaceutical compositions containing them US Patent US9603854 Publication Date 3/28/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
Type: | Homodimer or heterodimer |
Mol. Mass.: | 26269.11 |
Organism: | Homo sapiens (Human) |
Description: | P10415 |
Residue: | 239 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM177824 |
---|
n/a |
---|
Name | BDBM177824 |
Synonyms: | US9120791, Example 43 | US9603854, 43 |
Type | Small organic molecule |
Emp. Form. | C45H46ClN5O4 |
Mol. Mass. | 756.331 |
SMILES | CN1CCc2cc(ccc12)N(C(=O)c1cc(c2CCCCn12)-c1cc(Cl)ccc1C(=O)N1Cc2ccccc2C[C@H]1CN1CCOCC1)c1ccc(O)cc1 |
Structure |
|