| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM179827 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | SEAP Activity Assay |
|---|
| EC50 | >1000±n/a nM |
|---|
| Citation |  Barrett, SD; Germain, BD; Uzieblo, A; Ciske, FL; Endres, GW; Kornilov, A; Maxey, KM; O'Malley, JP; Owen, TA Lactam compounds as EP4 receptor-selective agonists for use in the treatment of EP4-mediated diseases and conditions US Patent US9676712 Publication Date 6/13/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM179827 |
|---|
| n/a |
|---|
| Name | BDBM179827 |
|---|
| Synonyms: | US9676712, 1C |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H35NO4 |
|---|
| Mol. Mass. | 401.539 |
|---|
| SMILES | O[C@H](CCCCc1ccccc1)\C=C\[C@H]1CCC(=O)N1CCCCCCC(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
