Reaction Details |
| Report a problem with these data |
Target | C-C chemokine receptor type 5 |
---|
Ligand | BDBM313955 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Calcium Flux Inhibition Experiment |
---|
IC50 | 1.95±n/a nM |
---|
Citation | Liu, H; Wu, B; Zheng, Y; Xie, X; Jiang, H; Peng, P; Luo, R; Li, J; Li, J; Zhu, Y; Chen, Y; Zhang, H; Yang, L; Zhou, Y; Chen, K 1-(3-aminopropyl) substituted cyclic amine compounds, preparation method therefor, and pharmaceutical compositions and uses thereof US Patent US10167299 Publication Date 1/1/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-C chemokine receptor type 5 |
---|
Name: | C-C chemokine receptor type 5 |
Synonyms: | C-C CKR-5 | C-C chemokine receptor type 5 | CC-CKR-5 | CCR-5 | CCR5 | CCR5/mu opioid receptor complex | CCR5_HUMAN | CD_antigen=CD195 | CHEMR13 | CMKBR5 | HIV-1 fusion coreceptor |
Type: | Enzyme |
Mol. Mass.: | 40540.21 |
Organism: | Homo sapiens (Human) |
Description: | P51681 |
Residue: | 352 |
Sequence: | MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
|
|
|
BDBM313955 |
---|
n/a |
---|
Name | BDBM313955 |
Synonyms: | Compound 3 | US10167299, Example 3 |
Type | Small organic molecule |
Emp. Form. | C27H39F2N5OS |
Mol. Mass. | 519.693 |
SMILES | CC(C)c1nnc(C)n1C1CC2CCC(C1)N2CCC(NC(=O)C1CCC(F)(F)CC1)c1cccs1 |THB:8:9:16:12.13| |
Structure |
|