Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase II alpha
LigandBDBM11318
Substrate/CompetitorCK-2 Peptide Substrate
Meas. Tech.Kinase Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
Ki 1850±n/a nM
IC50 890±n/a nM
Citation Sarno Sde Moliner ERuzzene MPagano MABattistutta RBain JFabbro DSchoepfer JElliott MFuret PMeggio FZanotti GPinna LA Biochemical and three-dimensional-structural study of the specific inhibition of protein kinase CK2 by [5-oxo-5,6-dihydroindolo-(1,2-a)quinazolin-7-yl]acetic acid (IQA). Biochem J 374:639-46 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Casein kinase II alpha
Name:Casein kinase II alpha
Synonyms:CK II | CK2 | CK2- alpha | CK2A1 | CSNK2A1 | Casein kinase II (CK2) | Casein kinase II alpha/beta | Casein kinase II subunit alpha | Casein kinase II subunit alpha (CK2 alpha) | Casein kinase II subunit alpha (CK2A1) | Casein kinase II subunit alpha (CK2a I174A) | Casein kinase II subunit alpha (CK2a V66A) | Casein kinase II subunit alpha (CK2a dm V66I174AA) | Casein kinase II subunit alpha (CK2a) | Casein kinase II subunit alpha (CK2α)
Type:Enzyme
Mol. Mass.:45151.12
Organism:Homo sapiens (Human)
Description:P68400
Residue:391
Sequence:
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11318
CK-2 Peptide Substrate
Name:CK-2 Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1446.31
Organism:n/a
Description:n/a
Residue:12
Sequence:
RRRADDSDDDDD