Reaction Details |
| Report a problem with these data |
Target | Major surface glycoprotein G |
---|
Ligand | BDBM194752 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Viral Cytopathic Effect (CPE) Assay |
---|
Citation | Gao, L; Guo, L; Liang, C; Wang, B; Wang, L; Yun, H; Zhang, W; Zheng, X Aza-oxo-indoles for the treatment and prophylaxis of respiratory syncytial virus infection US Patent US9670211 Publication Date 6/6/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Major surface glycoprotein G |
---|
Name: | Major surface glycoprotein G |
Synonyms: | Attachment glycoprotein G | G | GLYC_HRSV | Membrane-bound glycoprotein | mG |
Type: | Protein |
Mol. Mass.: | 32805.15 |
Organism: | Human respiratory syncytial virus A (strain Long) |
Description: | P20895 |
Residue: | 298 |
Sequence: | MSKNKDQRTAKTLEKTWDTLNHLLFISSGLYKLNLKSIAQITLSILAMIISTSLIITAII
FIASANHKVTLTTAIIQDATSQIKNTTPTYLTQDPQLGISFSNLSEITSQTTTILASTTP
GVKSNLQPTTVKTKNTTTTQTQPSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNP
TCWAICKRIPNKKPGKKTTTKPTKKPTFKTTKKDLKPQTTKPKEVPTTKPTEEPTINTTK
TNITTTLLTNNTTGNPKLTSQMETFHSTSSEGNLSPSQVSTTSEHPSQPSSPPNTTRQ
|
|
|
BDBM194752 |
---|
n/a |
---|
Name | BDBM194752 |
Synonyms: | US9670211, 3-3 |
Type | Small organic molecule |
Emp. Form. | C21H19ClN4O3S |
Mol. Mass. | 442.919 |
SMILES | Clc1ccc2n([C@@H]3CCS(=O)(=O)C3)c(CN3C(=O)C4(CC4)c4ccncc34)nc2c1 |r| |
Structure |
|