| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Major surface glycoprotein G |
|---|
| Ligand | BDBM195002 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Viral Cytopathic Effect (CPE) Assay |
|---|
| Citation |  Gao, L; Guo, L; Liang, C; Wang, B; Wang, L; Yun, H; Zhang, W; Zheng, X Aza-oxo-indoles for the treatment and prophylaxis of respiratory syncytial virus infection US Patent US9670211 Publication Date 6/6/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Major surface glycoprotein G |
|---|
| Name: | Major surface glycoprotein G |
|---|
| Synonyms: | Attachment glycoprotein G | G | GLYC_HRSV | Membrane-bound glycoprotein | mG |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 32805.15 |
|---|
| Organism: | Human respiratory syncytial virus A (strain Long) |
|---|
| Description: | P20895 |
|---|
| Residue: | 298 |
|---|
| Sequence: | MSKNKDQRTAKTLEKTWDTLNHLLFISSGLYKLNLKSIAQITLSILAMIISTSLIITAII
FIASANHKVTLTTAIIQDATSQIKNTTPTYLTQDPQLGISFSNLSEITSQTTTILASTTP
GVKSNLQPTTVKTKNTTTTQTQPSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNP
TCWAICKRIPNKKPGKKTTTKPTKKPTFKTTKKDLKPQTTKPKEVPTTKPTEEPTINTTK
TNITTTLLTNNTTGNPKLTSQMETFHSTSSEGNLSPSQVSTTSEHPSQPSSPPNTTRQ
|
|
|
|---|
| BDBM195002 |
|---|
| n/a |
|---|
| Name | BDBM195002 |
|---|
| Synonyms: | US9670211, 9-1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H18ClFN4O3S |
|---|
| Mol. Mass. | 460.909 |
|---|
| SMILES | Fc1cc(Cl)cc2nc(CN3C(=O)C4(CC4)c4ccncc34)n([C@H]3CCS(=O)(=O)C3)c12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
