| Reaction Details |
|---|
 | Report a problem with these data |
| Target | High affinity nerve growth factor receptor [441-796] |
|---|
| Ligand | BDBM136651 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ELISA Assay |
|---|
| pH | 7.5±n/a |
|---|
| IC50 | 4±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Haas, J; Andrews, SW; Jiang, Y; Zhang, G Method of treatment using substituted pyrazolo[1,5-A] pyrimidine compounds US Patent US9676783 Publication Date 6/13/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| High affinity nerve growth factor receptor [441-796] |
|---|
| Name: | High affinity nerve growth factor receptor [441-796] |
|---|
| Synonyms: | MTC | NTRK1 | NTRK1_HUMAN | TRK | TRKA | Tyrosine kinase receptor A | Tyrosine kinase receptor A (TrkA) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 39939.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human his-tagged TrkA cytoplasmic domain (441-796 aa) |
|---|
| Residue: | 356 |
|---|
| Sequence: | KCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDA
CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQRE
AELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPG
PLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDY
YRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCI
TQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
|
|
|
|---|
| BDBM136651 |
|---|
| n/a |
|---|
| Name | BDBM136651 |
|---|
| Synonyms: | US10005783, 68 | US10047097, 68 | US10774085, Example 68 | US11267818, Example 68 | US8865698, 68 | US9676783, 68 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H19FN6O |
|---|
| Mol. Mass. | 402.4243 |
|---|
| SMILES | Fc1cccc(c1)[C@H]1CCCN1c1ccn2ncc(NC(=O)c3ccccn3)c2n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
