Reaction Details |
| Report a problem with these data |
Target | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha |
---|
Ligand | BDBM13406 |
---|
Substrate/Competitor | K-ras(B) decapeptide |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
IC50 | 0.77±n/a nM |
---|
Citation | Wang, L; Wang, GT; Wang, X; Tong, Y; Sullivan, G; Park, D; Leonard, NM; Li, Q; Cohen, J; Gu, WZ; Zhang, H; Bauch, JL; Jakob, CG; Hutchins, CW; Stoll, VS; Marsh, K; Rosenberg, SH; Sham, HL; Lin, NH Design, synthesis, and biological activity of 4-[(4-cyano-2-arylbenzyloxy)-(3-methyl-3H-imidazol-4-yl)methyl]benzonitriles as potent and selective farnesyltransferase inhibitors. J Med Chem47:612-26 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha |
---|
Name: | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha |
Synonyms: | CAAX farnesyltransferase alpha subunit | FNTA | FNTA_HUMAN | FTase-1-alpha | FTase-alpha | GGTase-I-alpha | Geranylgeranyl Transferase (GGTase-I) Chain A | Geranylgeranyl transferase type I | Protein Farnesyltransferase (PFT) Chain A | Protein farnesyl/geranylgeranyl transferase | Protein farnesyltransferase | Protein farnesyltransferase subunit alpha | Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit | Ras proteins prenyltransferase alpha |
Type: | Enzyme |
Mol. Mass.: | 44392.46 |
Organism: | Homo sapiens (Human) |
Description: | Recombinant human FTase. |
Residue: | 379 |
Sequence: | MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDS
PSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLT
RDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLR
DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLL
DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
RSLQSKHSTENDSPTNVQQ
|
|
|
BDBM13406 |
---|
K-ras(B) decapeptide |
---|
Name: | K-ras(B) decapeptide |
Synonyms: | biotin conjugated K-ras decapeptide |
Type: | Peptide |
Mol. Mass.: | 1611.07 |
Organism: | n/a |
Description: | n/a |
Residue: | 14 |
Sequence: | |