Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM14480 |
---|
Substrate/Competitor | BDBM12679 |
---|
Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 16000±n/a nM |
---|
Citation | Katz, BA; Luong, C; Ho, JD; Somoza, JR; Gjerstad, E; Tang, J; Williams, SR; Verner, E; Mackman, RL; Young, WB; Sprengeler, PA; Chan, H; Mortara, K; Janc, JW; McGrath, ME Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA). J Mol Biol344:527-47 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
Type: | Enzyme |
Mol. Mass.: | 26557.80 |
Organism: | Homo sapiens (Human) |
Description: | P07477 |
Residue: | 247 |
Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
BDBM14480 |
---|
BDBM12679 |
---|
Name | BDBM14480 |
Synonyms: | CA-22 | [amino({4-[(3-hydroxynaphthalene-2-)amido]phenyl}amino)methylidene]azanium |
Type | Small organic molecule |
Emp. Form. | C18H17N4O2 |
Mol. Mass. | 321.3526 |
SMILES | [#7]\[#6](-[#7])=[#7+]/c1ccc(-[#7]-[#6](=O)-c2cc3ccccc3cc2-[#8])cc1 |
Structure |
|