Reaction Details |
| Report a problem with these data |
Target | Mitogen-activated protein kinase 1 |
---|
Ligand | BDBM5718 |
---|
Substrate/Competitor | Substrate Peptide T669 |
---|
Meas. Tech. | Kinase Inhibition Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 27000±n/a nM |
---|
Citation | Wang, Z; Canagarajah, BJ; Boehm, JC; Kassisa, S; Cobb, MH; Young, PR; Abdel-Meguid, S; Adams, JL; Goldsmith, EJ Structural basis of inhibitor selectivity in MAP kinases. Structure6:1117-28 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Mitogen-activated protein kinase 1 |
---|
Name: | Mitogen-activated protein kinase 1 |
Synonyms: | ERK-2 | ERT1 | Erk2 | Extracellular signal-regulated kinase 2 | MAP kinase 2 | MAPK 2 | MK01_RAT | Mapk | Mapk1 | Mitogen-activated protein kinase 2 | Prkm1 | p42-MAPK |
Type: | Enzyme |
Mol. Mass.: | 41278.65 |
Organism: | Rattus norvegicus (rat) |
Description: | MAP Kinase is the rat ERK-2 isoform containing a polyhistidine tag at the N-terminus produced in
E.coli. and activated by phosphorylation with MEK1 prior to purification. |
Residue: | 358 |
Sequence: | MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
|
|
BDBM5718 |
---|
Substrate Peptide T669 |
---|
Name: | Substrate Peptide T669 |
Synonyms: | epidermal growth factor receptor (EGFR) derived peptide T669 |
Type: | Peptide |
Mol. Mass.: | 2317.55 |
Organism: | n/a |
Description: | n/a |
Residue: | 21 |
Sequence: | |