Reaction Details |
| Report a problem with these data |
Target | Renin |
---|
Ligand | BDBM18026 |
---|
Substrate/Competitor | Green Flourescent Protein (tGFP) |
---|
Meas. Tech. | In Vitro Renin IC50 Determinations (Tandem GFP FRET Assay) |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 9.0±n/a nM |
---|
Citation | Holsworth, DD; Cai, C; Cheng, XM; Cody, WL; Downing, DM; Erasga, N; Lee, C; Powell, NA; Edmunds, JJ; Stier, M; Jalaie, M; Zhang, E; McConnell, P; Ryan, MJ; Bryant, J; Li, T; Kasani, A; Hall, E; Subedi, R; Rahim, M; Maiti, S Ketopiperazine-based renin inhibitors: optimization of the "C" ring. Bioorg Med Chem Lett16:2500-4 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Renin |
---|
Name: | Renin |
Synonyms: | Angiotensinogenase | REN | RENI_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 45058.99 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 406 |
Sequence: | MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
|
|
|
BDBM18026 |
---|
Green Flourescent Protein (tGFP) |
---|
Name: | Green Flourescent Protein (tGFP) |
Synonyms: | n/a |
Type: | Other Protein Type |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | The tGFP substrate contained a nine amino acid (Ile-His-Pro-Phe-His-Leu-Val-Ile-His) recognition sequence for human renin flanked by two GPF proteins (W1B and Topaz). |
Residue: | 3 |
Sequence: | |