| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18512 |
|---|
| Substrate/Competitor | BDBM18044 |
|---|
| Meas. Tech. | In Vitro Inhibition Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | >1000000±n/a nM |
|---|
| Citation |  Joska, TM; Anderson, AC Structure-activity relationships of Bacillus cereus and Bacillus anthracis dihydrofolate reductase: toward the identification of new potent drug leads. Antimicrob Agents Chemother50:3435-43 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate Reductase (DHFR) | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 19144.66 |
|---|
| Organism: | Bacillus cereus (ATCC 14579) |
|---|
| Description: | Q81E04 |
|---|
| Residue: | 162 |
|---|
| Sequence: | MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVVHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEIDMTNWKEIFVEKGLTDEKNPYTYYYHVYEKQQ
|
|
|
|---|
| BDBM18512 |
|---|
| BDBM18044 |
|---|
| Name | BDBM18512 |
|---|
| Synonyms: | 5-(4-chlorophenyl)-6-ethylpyrimidine-2,4-diamine | CHEMBL36 | Pyrimethamine (Pyr) | US11530198, Example Pyrimethamine | cid_4993 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H13ClN4 |
|---|
| Mol. Mass. | 248.711 |
|---|
| SMILES | CCc1nc(N)nc(N)c1-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
