Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurokinin 1 receptor
LigandBDBM21023
Substrate/CompetitorSubstance P
Meas. Tech.Radioligand Labeled Binding Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 0.6±n/a nM
Citation Yamamoto TNair PDavis PMa SWNavratilova EMoye STumati SLai JVanderah TWYamamura HIPorreca FHruby VJ Design, synthesis, and biological evaluation of novel bifunctional C-terminal-modified peptides for delta/mu opioid receptor agonists and neurokinin-1 receptor antagonists. J Med Chem 50:2779-86 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Neurokinin 1 receptor
Name:Neurokinin 1 receptor
Synonyms:NK-1 receptor | NK-1R | NK1 Receptor | Neurokinin NK1 | SPR | Substance-P receptor | TACR1 | Tachykinin receptor 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46371.54
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were carried out using membrane preparations from transfected CHO cells that constitutively expressed the rat NK1 receptor.
Residue:407
Sequence:
MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH
KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST
VVGAHEEEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21023
Substance P
Name:Substance P
Synonyms:[3H]Substance P
Type:Peptide
Mol. Mass.:3794.16
Organism:n/a
Description:n/a
Residue:33
Sequence:
H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2