Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 2C |
---|
Ligand | BDBM21358 |
---|
Substrate/Competitor | BDBM10755 |
---|
Meas. Tech. | Radioligand Labeled Binding Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 124±n/a nM |
---|
Comments | Agonism of cAMP production. |
---|
Citation | Cole, DC; Stock, JR; Lennox, WJ; Bernotas, RC; Ellingboe, JW; Boikess, S; Coupet, J; Smith, DL; Leung, L; Zhang, GM; Feng, X; Kelly, MF; Galante, R; Huang, P; Dawson, LA; Marquis, K; Rosenzweig-Lipson, S; Beyer, CE; Schechter, LE Discovery of N1-(6-chloroimidazo[2,1-b][1,3]thiazole-5-sulfonyl)tryptamine as a potent, selective, and orally active 5-HT(6) receptor agonist. J Med Chem50:5535-8 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
5-hydroxytryptamine receptor 2C |
---|
Name: | 5-hydroxytryptamine receptor 2C |
Synonyms: | 5-HT-1C | 5-HT-2C | 5-HT1C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 51836.79 |
Organism: | Homo sapiens (Human) |
Description: | P28335 |
Residue: | 458 |
Sequence: | MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
BDBM21358 |
---|
BDBM10755 |
---|
Name | BDBM21358 |
Synonyms: | 2-[1-({6-chloroimidazo[2,1-b][1,3]thiazole-5-}sulfonyl)-1H-indol-3-yl]ethan-1-amine | N1-(6-chloroimidazo[2,1-b][1,3]thiazole-5-sulfonyl)tryptamine | SAX-187 | WAY-181187 |
Type | Small organic molecule |
Emp. Form. | C15H13ClN4O2S2 |
Mol. Mass. | 380.872 |
SMILES | NCCc1cn(c2ccccc12)S(=O)(=O)c1c(Cl)nc2sccn12 |
Structure |
|