| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 6 |
|---|
| Ligand | BDBM21366 |
|---|
| Substrate/Competitor | BDBM21342 |
|---|
| Meas. Tech. | Radioligand Labeled Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 10.3±n/a nM |
|---|
| Comments | 5HT6 partial agonist. |
|---|
| Citation |  Cole, DC; Stock, JR; Lennox, WJ; Bernotas, RC; Ellingboe, JW; Boikess, S; Coupet, J; Smith, DL; Leung, L; Zhang, GM; Feng, X; Kelly, MF; Galante, R; Huang, P; Dawson, LA; Marquis, K; Rosenzweig-Lipson, S; Beyer, CE; Schechter, LE Discovery of N1-(6-chloroimidazo[2,1-b][1,3]thiazole-5-sulfonyl)tryptamine as a potent, selective, and orally active 5-HT(6) receptor agonist. J Med Chem50:5535-8 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 6 |
|---|
| Name: | 5-hydroxytryptamine receptor 6 |
|---|
| Synonyms: | 5-HT-6 | 5-HT6 | 5-hydroxytryptamine receptor 6 (5-HT-6) | 5-hydroxytryptamine receptor 6 (5-HT6R) | 5-hydroxytryptamine receptor 6 (5HT6) | 5HT6R_HUMAN | HTR6 | Serotonin (5-HT3) receptor | Serotonin 6 (5-HT6) receptor | Serotonin Receptor 6 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 46968.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P50406 |
|---|
| Residue: | 440 |
|---|
| Sequence: | MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
|
|
|
|---|
| BDBM21366 |
|---|
| BDBM21342 |
|---|
| Name | BDBM21366 |
|---|
| Synonyms: | (2-{3-[(3-fluorobenzene)sulfonyl]-1H-indol-1-yl}ethyl)dimethylamine | CHEMBL366151 | flipped tryptamine derivative, 10 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H19FN2O2S |
|---|
| Mol. Mass. | 346.419 |
|---|
| SMILES | CN(C)CCn1cc(c2ccccc12)S(=O)(=O)c1cccc(F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
