| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase |
|---|
| Ligand | BDBM21684 |
|---|
| Substrate/Competitor | PDF substrate peptide |
|---|
| Meas. Tech. | PDF Inhibition Assay |
|---|
| pH | 7.6±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 2200±100 nM |
|---|
| Km | 2600000±n/a nM |
|---|
| kcat | 152±n/a 1/sec |
|---|
| Citation |  Smith, KJ; Petit, CM; Aubart, K; Smyth, M; McManus, E; Jones, J; Fosberry, A; Lewis, C; Lonetto, M; Christensen, SB Structural variation and inhibitor binding in polypeptide deformylase from four different bacterial species. Protein Sci12:349-60 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Peptide deformylase |
|---|
| Name: | Peptide deformylase |
|---|
| Synonyms: | DEF_STAAM | PDF | Polypeptide deformylase | def | def1 | pdf1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 20556.80 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | P68825 |
|---|
| Residue: | 183 |
|---|
| Sequence: | MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDA
VEV
|
|
|
|---|
| BDBM21684 |
|---|
| PDF substrate peptide |
|---|
| Name: | PDF substrate peptide |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 1718.01 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 14 |
|---|
| Sequence: | |
|---|
Search and Browse
